Autophagy-related protein 8

UniProt : P38182, UniProt ID: ATG8_YEAST,

Autophagy-related protein 8

Saccharomyces cerevisiae

MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQF
VYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Autophagy-related protein 8 contains a PF02991 domain.

Autophagy-related protein 8 is proteolytically cut by ATG4 peptidase (C54.001) cleavage. NTFG-R---.

Autophagy-related protein 8 is proteolytically cut by ATG4 peptidase (C54.001) cleavage. GWGC-MIRT.