cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor)
|
UniProt : B2R5H8, P03973, UniProt ID: B2R5H8_HUMAN, SLPI_HUMAN, cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) Homo sapiens MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG MCGKSCVSPVKA The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) contains a PF00095 domain.
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) contains a PF00095 domain.
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by gingipain R1 (C25.001) cleavage..
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by gingipain 2 (C25.003) cleavage..
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by gingipain R1 (C25.001) cleavage..
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by gingipain 2 (C25.003) cleavage..
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QCLM-LNPP.
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QCLR-YKKP.
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by cathepsin S (C01.034) cleavage. CPDT-CGIK.
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by cathepsin B (C01.060) cleavage. CPDT-CGIK.
cDNA, FLJ92479, Homo sapiens secretory leukocyte protease inhibitor(antileukoproteinase) (SLPI), mRNA (Secretory leukocyte peptidase inhibitor) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. AVEG-SGKS.