CASP10 protein (Caspase 10, apoptosis-related cysteine peptidase) (Caspase 10, apoptosis-related cysteine peptidase, isoform CRA_c) (Putative uncharacterized protein CASP10)

UniProt : Q8IUP5, UniProt ID: Q8IUP5_HUMAN,

CASP10 protein (Caspase 10, apoptosis-related cysteine peptidase) (Caspase 10, apoptosis-related cysteine peptidase, isoform CRA_c) (Putative uncharacterized protein CASP10)

Homo sapiens

MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASD
VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLY
ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPK
LLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDR
QGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGR
FGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPE
QAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSIL
TAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CASP10 protein (Caspase 10, apoptosis-related cysteine peptidase) (Caspase 10, apoptosis-related cysteine peptidase, isoform CRA_c) (Putative uncharacterized protein CASP10) contains a PF00656 domain.

CASP10 protein (Caspase 10, apoptosis-related cysteine peptidase) (Caspase 10, apoptosis-related cysteine peptidase, isoform CRA_c) (Putative uncharacterized protein CASP10) contains a PF01335 domain.

CASP10 protein (Caspase 10, apoptosis-related cysteine peptidase) (Caspase 10, apoptosis-related cysteine peptidase, isoform CRA_c) (Putative uncharacterized protein CASP10) contains a PF01335 domain.

CASP10 protein (Caspase 10, apoptosis-related cysteine peptidase) (Caspase 10, apoptosis-related cysteine peptidase, isoform CRA_c) (Putative uncharacterized protein CASP10) is proteolytically cut by caspase-10 (C14.011) cleavage. SQTD-VKTF.

CASP10 protein (Caspase 10, apoptosis-related cysteine peptidase) (Caspase 10, apoptosis-related cysteine peptidase, isoform CRA_c) (Putative uncharacterized protein CASP10) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IEAD-ALNP.