cDNA, FLJ93429, Homo sapiens alpha-2-HS-glycoprotein (AHSG), mRNA (Alpha-2-HS-glycoprotein, isoform CRA_c)

UniProt : B2R7G1, P02765, UniProt ID: B2R7G1_HUMAN, FETUA_HUMAN,

cDNA, FLJ93429, Homo sapiens alpha-2-HS-glycoprotein (AHSG), mRNA (Alpha-2-HS-glycoprotein, isoform CRA_c)

Homo sapiens

MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTL
NQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLK
LDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNF
QLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGG
AEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPG
RIRHFKV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93429, Homo sapiens alpha-2-HS-glycoprotein (AHSG), mRNA (Alpha-2-HS-glycoprotein, isoform CRA_c) contains a PF00031 domain.

cDNA, FLJ93429, Homo sapiens alpha-2-HS-glycoprotein (AHSG), mRNA (Alpha-2-HS-glycoprotein, isoform CRA_c) contains a PF00031 domain.

cDNA, FLJ93429, Homo sapiens alpha-2-HS-glycoprotein (AHSG), mRNA (Alpha-2-HS-glycoprotein, isoform CRA_c) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..