cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase)

UniProt : B2R8B8, P08254, UniProt ID: B2R8B8_HUMAN, MMP3_HUMAN,

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase)

Homo sapiens

MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) contains a PF00045 domain.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) contains a PF00045 domain.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) contains a PF00045 domain.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) contains a PF00045 domain.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) contains a PF00413 domain.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) contains a PF01471 domain.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) is proteolytically cut by trypsin () cleavage..

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DTLE-VMRK.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DVGH-FRTF.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) is proteolytically cut by furin (S08.071) cleavage. RKPR-CGVP.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DTLE-VMRK.

cDNA, FLJ93823, Homo sapiens matrix metalloproteinase 3 (stromelysin 1,progelatinase) (MMP3), mRNA (Matrix metallopeptidase 3) (Stromelysin 1, progelatinase) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DVGH-FRTF.