cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a)

UniProt : B2R9A9, P10915, UniProt ID: B2R9A9_HUMAN, HPLN1_HUMAN,

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a)

Homo sapiens

MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDS
DASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) contains a PF00193 domain.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) contains a PF07686 domain.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) contains a PF00193 domain.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-10 (M10.006) cleavage. GPHL-LVEA.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-10 (M10.006) cleavage. RAIH-IQAE.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RAIH-IQAE.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GPHL-LVEA.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. RAIH-IQAE.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. GPHL-LVEA.

cDNA, FLJ94306, Homo sapiens cartilage linking protein 1 (CRTL1), mRNA (Hyaluronan and proteoglycan link protein 1, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. RAIH-IQAE.