Glucagon

UniProt : P01275, UniProt ID: GLUC_HUMAN,

Glucagon

Homo sapiens

MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Glucagon contains a PF00123 domain.

Glucagon contains a PF00123 domain.

Glucagon contains a PF00123 domain.

Glucagon is proteolytically cut by meprin beta subunit (M12.004) cleavage. RRAQ-DFVQ.

Glucagon is proteolytically cut by meprin beta subunit (M12.004) cleavage. DSRR-AQDF.

Glucagon is proteolytically cut by meprin beta subunit (M12.004) cleavage. SKYL-DSRR.

Glucagon is proteolytically cut by meprin beta subunit (M12.004) cleavage. TFTS-DYSK.

Glucagon is proteolytically cut by meprin beta subunit (M12.004) cleavage. HSQG-TFTS.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. FVQW-LMNT.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RRAQ-DFVQ.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. RAQD-FVQW.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. LDSR-RAQD.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. KYLD-SRRA.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. SKYL-DSRR.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. DYSK-YLDS.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. YSKY-LDSR.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. SDYS-KYLD.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. TSDY-SKYL.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. TFTS-DYSK.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. FTSD-YSKY.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. GTFT-SDYS.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. KRHS-QGTF.

Glucagon is proteolytically cut by meprin alpha subunit (M12.002) cleavage. QGTF-TSDY.

Glucagon is proteolytically cut by (S9G.034) cleavage. VQWL-MNT-.

Glucagon is proteolytically cut by (S9G.034) cleavage. AQDF-VQWL.

Glucagon is proteolytically cut by (S9G.034) cleavage. YSKY-LDSR.

Glucagon is proteolytically cut by (S9G.034) cleavage. TSDY-SKYL.

Glucagon is proteolytically cut by (S9G.034) cleavage. QGTF-TSDY.

Glucagon is proteolytically cut by thermomycolin (S08.057) cleavage. DFVQ-WLMN.

Glucagon is proteolytically cut by chymotrypsin A (S01.001) cleavage. VQWL-MNT-.

Glucagon is proteolytically cut by chymotrypsin A (S01.001) cleavage. FVQW-LMNT.

Glucagon is proteolytically cut by chymotrypsin A (S01.001) cleavage. AQDF-VQWL.

Glucagon is proteolytically cut by chymotrypsin A (S01.001) cleavage. YSKY-LDSR.

Glucagon is proteolytically cut by chymotrypsin A (S01.001) cleavage. TSDY-SKYL.

Glucagon is proteolytically cut by chymotrypsin A (S01.001) cleavage. QGTF-TSDY.

Glucagon is proteolytically cut by peptidyl-Asp metallopeptidase (M72.001) cleavage. RRAQ-DFVQ.

Glucagon is proteolytically cut by peptidyl-Asp metallopeptidase (M72.001) cleavage. SKYL-DSRR.

Glucagon is proteolytically cut by peptidyl-Asp metallopeptidase (M72.001) cleavage. TFTS-DYSK.

Glucagon is proteolytically cut by hyicolysin (M30.001) cleavage..

Glucagon is proteolytically cut by hyicolysin (M30.001) cleavage. DFVQ-WLMN.

Glucagon is proteolytically cut by hyicolysin (M30.001) cleavage. DSRR-AQDF.

Glucagon is proteolytically cut by hyicolysin (M30.001) cleavage. KYLD-SRRA.

Glucagon is proteolytically cut by hyicolysin (M30.001) cleavage. TFTS-DYSK.

Glucagon is proteolytically cut by (M12.308) cleavage. RAQD-FVQW.

Glucagon is proteolytically cut by (M12.308) cleavage. KYLD-SRRA.

Glucagon is proteolytically cut by (M12.308) cleavage. YSKY-LDSR.

Glucagon is proteolytically cut by (M12.308) cleavage. GTFT-SDYS.

Glucagon is proteolytically cut by (M12.308) cleavage. SQGT-FTSD.

Glucagon is proteolytically cut by lebetase (M12.164) cleavage. TSDY-SKYL.

Glucagon is proteolytically cut by leishmanolysin (M08.001) cleavage. FVQW-LMNT.

Glucagon is proteolytically cut by leishmanolysin (M08.001) cleavage. KYLD-SRRA.

Glucagon is proteolytically cut by leishmanolysin (M08.001) cleavage. TSDY-SKYL.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. VQWL-MNT-.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. FVQW-LMNT.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. AQDF-VQWL.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. DSRR-AQDF.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. YLDS-RRAQ.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. SKYL-DSRR.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. YSKY-LDSR.

Glucagon is proteolytically cut by phytepsin (A01.020) cleavage. FTSD-YSKY.