Glucagon
UniProt : P29794, UniProt ID: GLUC_CANFA, Glucagon Canis familiaris MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTS DYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI AWLVKGRGRRDFPEEVAIVEEFRRRHADGSFSDEMNTVLDTLATRDFINWLLQTKITDRK The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Glucagon contains a PF00123 domain.
Glucagon contains a PF00123 domain.
Glucagon contains a PF00123 domain.
Glucagon is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. NTKR-NKNN.
Glucagon is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. EDKR-HSQG.
Glucagon is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. EFER-HAEG.
Glucagon is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. IAKR-HDEF.
Glucagon is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. NTKR-NKNN.
Glucagon is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. FRRR-HADG.
Glucagon is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RGRR-DFPE.