Homo sapiens

MKSIYFVAGLFVMLVQGSWQQDTEEKSRSLRSFSASQADPLSDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. EDKR-HSQG.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. NTKR-NRNN.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. EFER-HAEG.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. IAKR-HDEF.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. NTKR-NRNN.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. LGRR-HADG.

is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RGRR-DFPE.