Semenogelin II

UniProt : Q02383, Q53ZU2, UniProt ID: Q53ZU2_HUMAN, SEMG2_HUMAN,

Semenogelin II

Homo sapiens

MKSIILFVLSLLLILEKQAAVMGQKGGSKGQLPSGSSQFPHGQKGQHYFGQKDQQHTKSK
GSFSIQHTYHVDINDHDWTRKSQQYDLNALHKATKSKQHLGGSQQLLNYKQEGRDHDKSK
GHFHMIVIHHKGGQAHHGTQNPSQDQGNSPSGKGLSSQCSNTEKRLWVHGLSKEQASASG
AQKGRTQGGSQSSYVLQTEELVVNKQQRETKNSHQNKGHYQNVVDVREEHSSKLQTSLHP
AHQDRLQHGPKDIFTTQDELLVYNKNQHQTKNLSQDQEHGRKAHKISYPSSRTEERQLHH
GEKSVQKDVSKGSISIQTEEKIHGKSQNQVTIHSQDQEHGHKENKISYQSSSTEERHLNC
GEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKENKISYQSSSTEERRLNS
GEKDVQKGVSKGSISIQTEEKIHGKSQNQVTIPSQDQEHGHKENKMSYQSSSTEERRLNY
GGKSTQKDVSQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSH
EQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Semenogelin II contains a PF05474 domain.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RLNY-GGKS.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RRLN-SGEK.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. IPSQ-AQEY.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RHLN-CGEK.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SQNQ-VTIH.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QLHH-GEKS.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. PAHQ-DRLQ.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QSSY-VLQT.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SKLQ-TSLH.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. GHYQ-NVVD.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SKQH-LGGS.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SQQY-DLNA.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QHTY-HVDI.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QHTK-SKGS.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. MSYQ-SSST.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. MSYQ-SSST.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ISYQ-SSST.

Semenogelin II is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ISYQ-SSST.

Semenogelin II is proteolytically cut by kallikrein hK2 (S01.161) cleavage. QKGR-YKQE.

Semenogelin II is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EERR-LNYG.

Semenogelin II is proteolytically cut by kallikrein hK2 (S01.161) cleavage. PSSR-TEER.

Semenogelin II is proteolytically cut by kallikrein hK2 (S01.161) cleavage. NQVR-IPSQ.

Semenogelin II is proteolytically cut by kallikrein hK2 (S01.161) cleavage. TEKR-LWVH.

Semenogelin II is proteolytically cut by kallikrein hK2 (S01.161) cleavage. HQDR-LQHG.

Semenogelin II is proteolytically cut by kallikrein hK2 (S01.161) cleavage. GHFH-MIVI.