Alpha-2-HS-glycoprotein

UniProt : B0JYN6, P12763, UniProt ID: B0JYN6_BOVIN, FETUA_BOVIN,

Alpha-2-HS-glycoprotein

Bos taurus

MKSFVLLFCLAQLWGCHSIPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTL
NQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLK
QDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYL
QLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALG
GEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAV
PLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Alpha-2-HS-glycoprotein contains a PF00031 domain.

Alpha-2-HS-glycoprotein contains a PF00031 domain.

Alpha-2-HS-glycoprotein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. PPVA-SVVV.

Alpha-2-HS-glycoprotein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. YDLR-HTFS.

Alpha-2-HS-glycoprotein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. YDLR-HTFS.