cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c)

UniProt : B2R7G3, P02675, UniProt ID: B2R7G3_HUMAN, FIBB_HUMAN,

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c)

Homo sapiens

MKRMVSWSFHKLKTMKHLLLLLLCVFLVKSQGVNDNEEGFFSARGHRPLDKKREEAPSLR
PAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQEALLQQE
RPIRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQ
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKE
CEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYK
QGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFT
VQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDP
RKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKM
SMKIRPFFPQQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) contains a PF00147 domain.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by tryptase (S01.143) cleavage. PLDK-KREE.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by tryptase (S01.143) cleavage. PLDK-KREE.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage. ATQK-KVER.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by tryptase (S01.143) cleavage. PLDK-KREE.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage. ATQK-KVER.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by gabonase (S01.430) cleavage. FSAR-GHRP.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by thrombin (S01.217) cleavage. FSAR-GHRP.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by staphopain B (C47.002) cleavage. GGYR-ARPA.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. ERPI-RNSV.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by SprE glutamyl peptidase (S01.423) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by graminelysin (M12.163) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by kallikrein hK14 (S01.029) cleavage. FSAR-GHRP.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by tryptase (S01.143) cleavage. PLDK-KREE.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage. ATQK-KVER.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by gabonase (S01.430) cleavage. FSAR-GHRP.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by thrombin (S01.217) cleavage. FSAR-GHRP.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by staphopain B (C47.002) cleavage. GGYR-ARPA.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. ERPI-RNSV.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by SprE glutamyl peptidase (S01.423) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by graminelysin (M12.163) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by kallikrein hK14 (S01.029) cleavage. FSAR-GHRP.

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by inhA g.p. (M06.001) cleavage..

cDNA, FLJ93433, highly similar to Homo sapiens fibrinogen, B beta polypeptide (FGB), mRNA (Fibrinogen beta chain, isoform CRA_c) is proteolytically cut by neutral protease Npr599 () cleavage..