Prophenoloxidase activating factor

UniProt : Q9GRW0, UniProt ID: Q9GRW0_HOLDI,

Prophenoloxidase activating factor

Holotrichia diomphalia

MKRLFVITAFFLFGAEAQNSVIDAAVVNIFGNASEYIPPGYEIVTKAPLGALTALPRCGT
GADQGKKVCIVYHRCDGVTNTVTPEEVINTTGEGIFDIRENANECESYLDVCCGLPEGGV
LPTPSPTPPVVPVLKPSFCGIRNERGLDFKITGQTNEAEYGEFPWMVAVLKANVIPGSGE
EQLVCGGSLIAPSVVLTGAHCVNSYQSNLDAIKIRAGEWDTLTEKERLPYQERKIRQVII
HSNFNPKTVVNDVALLLLDRPLVQADNIGTICLPQQSQIFDSTECFASGWGKKEFGSRHR
YSNILKKIQLPTVDRDKCQADLRNTRLGLKFVLDQTFVCAGGEQGKDTCTGDGGSPLFCP
DPRNPSRYMQMGIVAWGIGCGDENVPGVYANVAHFRNWIDQEMQAKGLSTTPYVE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Prophenoloxidase activating factor contains a PF00089 domain.

Prophenoloxidase activating factor is proteolytically cut by prophenoloxidase-activating peptidase (S01.UNA) cleavage. LDFK-ITGQ.