Semenogelin I (Semenogelin I, isoform CRA_a)

UniProt : P04279, Q53ZV1, UniProt ID: Q53ZV1_HUMAN, SEMG1_HUMAN,

Semenogelin I (Semenogelin I, isoform CRA_a)

Homo sapiens

MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESK
GSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSK
GHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSG
AQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCP
AHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
GENGVQKDVSQSSIYSQTEEKAQGKSQKQITIPSQEQEHSQKANKISYQSSSTEERRLHY
GENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSH
EQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Semenogelin I (Semenogelin I, isoform CRA_a) contains a PF05474 domain.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. KAHR-GTQN.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EERR-LHYG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EERR-LHYG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. VSQR-SIYS.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. KAHR-GTQN.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EERR-LHYG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EERR-LHYG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK2 (S01.161) cleavage. VSQR-SIYS.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. HGGL-DIVI.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RNPL-FT.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. KISY-QSSS.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ERRL-HYGE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. TEKL-VAGK.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. EQDL-LSHE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. TKNL-NQDQ.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. KISY-QSSS.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ERRL-HYGE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. KGHY-QNVV.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QDKL-QHGS.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. KDIF-STQD.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. DELL-VYNK.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QSSY-VLQT.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SYVL-QTEE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. TEEL-VANK.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ISSQ-YSNT.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QQLL-HNKQ.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SIQY-TYHV.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QSTN-REQD.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RSIY-SQTE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RSIY-SQTE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. VQKD-VSQR.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. IPSQ-EQEH.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QLLH-NKQE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. VQKD-VSQS.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RLHY-GENG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RLHY-GENG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ISYQ-SSST.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ISYQ-SSST.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SSIY-SQTE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SSIY-SQTE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RLHY-GENG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. RLHY-GENG.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ISYQ-SSST.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. ISYQ-SSST.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. LLVY-NKNQ.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. LLVY-NKNQ.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SKVQ-TSLC.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. GHYQ-NVVE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SSQY-SNTE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SSQY-SNTE.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SQQY-DLNA.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. SQQY-DLNA.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. QYTY-HVDA.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. GQHY-SGQK.

Semenogelin I (Semenogelin I, isoform CRA_a) is proteolytically cut by kallikrein hK3 (S01.162) cleavage. GQHY-SGQK.