Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b)

UniProt : A4D1X9, P49418, UniProt ID: A4D1X9_HUMAN, AMPH_HUMAN,

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b)

Homo sapiens

MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHAD
KAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTRKG
PPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFK
PEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSM
ICNLAESEQAPPTEPKAEEPLAAVTPAVGLDLGMDTRAEEPVEEAVIIPGADADAAVGTL
VSAAEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVI
PSVVIEPASNHEEEGENEITIGAEPKETTEDAAPPGPTSETPELATEQKPIQDPQPTPSA
PAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQ
DAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) contains a PF03114 domain.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) contains a PF00018 domain.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. PEIS-VTTP.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. SPMS-QTLP.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. TDLV-QPAS.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. DLGM-DTRA.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. AAVG-TLVS.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. QPEA-EELE.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. EELE-ATVP.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. PIQD-PQPT.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-2 (C02.002) cleavage. ADQL-ASAR.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. PEIS-VTTP.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. SPMS-QTLP.

Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) (Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen), isoform CRA_b) is proteolytically cut by calpain-1 (C02.001) cleavage. TDLV-QPAS.