Progonadoliberin-1

UniProt : P01148, UniProt ID: GON1_HUMAN,

Progonadoliberin-1

Homo sapiens

MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR
FECTTHQPRSPLRDLKGALESLIEEETGQKKI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Progonadoliberin-1 contains a PF00446 domain.

Progonadoliberin-1 is proteolytically cut by thimet oligopeptidase (M03.001) cleavage. HWSY-GLRP.

Progonadoliberin-1 is proteolytically cut by oligopeptidase B (S09.010) cleavage. GLRP-G---.