Progonadoliberin-1
|
UniProt : P01148, UniProt ID: GON1_HUMAN, Progonadoliberin-1 Homo sapiens MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR FECTTHQPRSPLRDLKGALESLIEEETGQKKI The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Progonadoliberin-1 contains a PF00446 domain.
Progonadoliberin-1 is proteolytically cut by thimet oligopeptidase (M03.001) cleavage. HWSY-GLRP.
Progonadoliberin-1 is proteolytically cut by oligopeptidase B (S09.010) cleavage. GLRP-G---.