Homo sapiens

MKPIQKLLAGLILLTSCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR
FECTTHQPRSPLRDLKGALESLIEEETGQKKI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by meprin alpha subunit (M12.002) cleavage. QHWS-YGLR.

is proteolytically cut by meprin alpha subunit (M12.002) cleavage. HWSY-GLRP.

is proteolytically cut by meprin alpha subunit (M12.002) cleavage. WSYG-LRPG.

is proteolytically cut by meprin alpha subunit (M12.002) cleavage. SYGL-RPGG.

is proteolytically cut by meprin alpha subunit (M12.002) cleavage. SQHW-SYGL.

is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. GGKR-DAEN.