Metalloprotease (Fragilysin)

UniProt : Q9S5W0, UniProt ID: Q9S5W0_BACFR,

Metalloprotease (Fragilysin)

Bacteroides fragilis

MKNVKLLLMLGTAALLAACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGK
MIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGES
ISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKA
KKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQ
MQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQI
YFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTD
NSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Metalloprotease (Fragilysin) contains a PF00413 domain.

Metalloprotease (Fragilysin) is proteolytically cut by fragilysin (M10.020) cleavage. YVIC-LREN.

Metalloprotease (Fragilysin) is proteolytically cut by fragilysin (M10.020) cleavage. FTAS-LKSN.