Somatostatin-1

UniProt : P01169, UniProt ID: SMS1_LOPAM,

Somatostatin-1

Lophius americanus

MKMVSSSRLRCLLVLLLSLTASISCSFAGQRDSKLRLLLHRYPLQGSKQDMTRSALAELL
LSDLLQGENEALEEENFPLAEGGPEDAHADLERAASGGPLLAPRERKAGCKNFFWKTFTS
C

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Somatostatin-1 contains a PF03002 domain.

Somatostatin-1 is proteolytically cut by yapsin 3 (A01.035) cleavage. PRER-KAGC.

Somatostatin-1 is proteolytically cut by yapsin 1 (A01.030) cleavage. DLER-AASG.