PMAP: SubstrateDB : TGFB3 protein (Transforming growth factor, beta 3) (cDNA, FLJ94128, Homo sapiens transforming growth factor, beta 3 (TGFB3), mRNA)

TGFB3 protein (Transforming growth factor, beta 3) (cDNA, FLJ94128, Homo sapiens transforming growth factor, beta 3 (TGFB3), mRNA)

UniProt : A5YM40, P10600, UniProt ID: A5YM40_HUMAN, TGFB3_HUMAN,

TGFB3 protein (Transforming growth factor, beta 3) (cDNA, FLJ94128, Homo sapiens transforming growth factor, beta 3 (TGFB3), mRNA)

Homo sapiens

MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

TGFB3 protein (Transforming growth factor, beta 3) (cDNA, FLJ94128, Homo sapiens transforming growth factor, beta 3 (TGFB3), mRNA) contains a PF00019 domain.

TGFB3 protein (Transforming growth factor, beta 3) (cDNA, FLJ94128, Homo sapiens transforming growth factor, beta 3 (TGFB3), mRNA) contains a PF00688 domain.

TGFB3 protein (Transforming growth factor, beta 3) (cDNA, FLJ94128, Homo sapiens transforming growth factor, beta 3 (TGFB3), mRNA) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. CPKG-ITSK.