cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a)

UniProt : B2R793, P35318, UniProt ID: ADML_HUMAN, B2R793_HUMAN,

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a)

Homo sapiens

MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVK
AGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKL
AHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGS
APHFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a) contains a PF02039 domain.

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. KWNK-WALS.

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. WNKW-ALSR.

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. NKWA-LSRG.

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. FRKK-WNKW.

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. DTAR-LDVA.

cDNA, FLJ93337, Homo sapiens adrenomedullin (ADM), mRNA (Adrenomedullin, isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. VASE-FRKK.