ADR056Wp

UniProt : Q75A62, UniProt ID: Q75A62_ASHGO,

ADR056Wp

Ashbya gossypii

MKLSTVVAGGLLAAQQVLGDCDFIGGNYYCSKAENIRYANVGYSGTYLDVTSMDEKSCKC
KQRKLEFSGSLSPLDQELTVHFRGPLRLKQFGVYYPAGSDGGSEQKPGHKHNSGHKHKPG
HDHDKRAVHYVHVTSTVYVKGGAHAETPVAAAPASTSEPAKAVESAPAPLSESAPAPLLE
SAPAPPSKSAPAPSLESAPSSSLSSLSQSASPSSKEEGKGGLHSFLTKVFGDHGHKQSSS
STSSAAQASSTGAGSSSVSGWKRVAHYTPGSTDNCTFFNHQGGKGSGTWSQCFGNSISFA
SSDGRSGASNPTPLDDVTFKSNEEIMIFSGASCKDKSLGDCGFHRDKIPAYHGFGGATKM
FVFEFTMPSDEHGNDYNQDMPAIWLLNAKIPRTLQYGDSSCSCWKTGCGEMDLFEVLSKG
SKYMISHIHDGQGNDGYNVGGGGSQDYFERPLQRPMKAAVIFDGENSNVHIVEVDGDFEA
SLSASTVQNWISKEGTVAMLP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ADR056Wp is proteolytically cut by kexin (S08.070) cleavage. HDKR-AVHY.