Putative uncharacterized protein

UniProt : Q5AA24, UniProt ID: Q5AA24_CANAL,

Putative uncharacterized protein

Candida albicans

MKLSTTTALAVLATATAINAAPEQQQQQESQFASKALTKREEQDIQELVQHINNYKTRRD
AIDEEIMKRDYAIVTDVLAAINQSQLAPKILDYLVSNETFKPIVVNVTIATMKSGIISLQ
ALLDALVSSNLAVNLVNDLISDCSLYVELFNAAKSVINDLASKVKGLISKGVSQLITRDE
TDIDALAPYVVTMEKRLDLDGVVDNLLDSLYKSGLATSVVKDILTNSDYIPFATDLIKAM
IANNLIDLGNIVDAVKQSGLVTQLFQKLVNFGTVQTVAETAFAAYAGECQGSGAISGGSG
SGSGSGSGSGSGTSTITTGGSSSGGSSGGSSHGSSAGPCKKRRRRRRRSNY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein is proteolytically cut by kexin (S08.070) cleavage. LTKR-EEQD.

Putative uncharacterized protein is proteolytically cut by kexin (S08.070) cleavage. KTRR-DAID.

Putative uncharacterized protein is proteolytically cut by kexin (S08.070) cleavage. IMKR-DYAI.

Putative uncharacterized protein is proteolytically cut by kexin (S08.070) cleavage. MEKR-LDLD.