DEHA2C07370p

UniProt : Q6BUW7, UniProt ID: Q6BUW7_DEBHA,

DEHA2C07370p

Debaryomyces hansenii

MKLSTTSAALILALTASINAAPAGTPTTTSLTKRDAENIGKAIALLNDYNAKRETSPSYA
LAERDYPIVTTVLGYIKDTDLSSKILLYFVTDDFFAPIVKKTIISLIKNGTINLTTLFTS
LNNSGLAAQVIEDLINDCNFYGEIYKLAGSYIGDLFDKIKDKISNIGSSKRESLEERALT
TASQIPDSEDDNSVLTELMESLKKSGLGTQVVEELIVNKEFLSFGADLIKEMIDQKAITL
GELVDAIKDSGLVPSLFKQFFTLDTLKTVTVNALAAAFNKCDGDNATATVSSDVGSETSG
TTPTSGTSTSTSTGGSTNPTCKKRKRSYY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DEHA2C07370p is proteolytically cut by kexin (S08.070) cleavage. LTKR-DAEN.

DEHA2C07370p is proteolytically cut by kexin (S08.070) cleavage. NAKR-ETSP.

DEHA2C07370p is proteolytically cut by kexin (S08.070) cleavage. LAER-DYPI.

DEHA2C07370p is proteolytically cut by kexin (S08.070) cleavage. SSKR-ESLE.