DEHA2E14564p

UniProt : Q6BPD1, UniProt ID: Q6BPD1_DEBHA,

DEHA2E14564p

Debaryomyces hansenii

MKLSQTTLFAILASSAFVSAAPAAVVAENSLVTRGDANEILEILSSLKQVNEKRDLVSES
ESFELSKRADGLVTELVAALASSGVIADVWDTLTQDETLKSEILNIVKTTVKAALVQGPA
LLKAIWDSGLISKLFHDILNDSDLRSVLLKVAKSLFSNALNLLKAYKSGSSGSSTTATTA
VAVALSTDNSAATGSSSSGSDVDISGIPSPSEYNSGAKRDFIDGEFLDKRDVASIVVTVA
KQIKDSGLVSSLIQKVMADPEKSITFLTSLLKKGFVLAEDLIGWAKNSGLLNEALEYLEK
NGGQYSSALASFLGDQIESGNVTASDIDNAGTSSALTGTTIATTAVNTQITTAATTATTL
QQVRRAY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DEHA2E14564p is proteolytically cut by kexin (S08.070) cleavage. NEKR-DLVS.

DEHA2E14564p is proteolytically cut by kexin (S08.070) cleavage. LVTR-GDAN.

DEHA2E14564p is proteolytically cut by kexin (S08.070) cleavage. LSKR-ADGL.

DEHA2E14564p is proteolytically cut by kexin (S08.070) cleavage. GAKR-DFID.