FAS1 domain-containing protein CaO19.3004

UniProt : Q5AI48, UniProt ID: YFAS1_CANAL,

FAS1 domain-containing protein CaO19.3004

Candida albicans

MKLSKLLQLAVFSSLVTSKNIFDLESLKQGLQDEETVNNDKREPVNLLYLDRFKMGVSDE
AKGNAKFKRDPKNVIDPASLKEGSAEEEQKDKREPKNLFNLQALHEGLKDEETKSKREAK
NLPNLEALEEALKGGSLPKKDAKNLIDLVALKQSLEKEAAKRDAKNIPDLEALKTGIEEE
EGQVAKRDAKNVINLSNFIETPSKREGKNLFDLTKFQQSGQPIKKRDQKILKQEKSLFVL
NSVDCFNNLLQSILPQLSSISIFSSYIRQFASIDARTANPQKVMLIVAPDNDSLETKLSD
LKPWEFPEQITPEQSEQEQDKTLKNNLLHFLNGHLINNFEENLVIDKSSTDAVTIISKLN
NGKFLKIKQDQLSQKFSIRLLDSENWIDVETIKQVENGFVLIINDSLVKP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. NDKR-EPVN.

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. KFKR-DPKN.

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. KDKR-EPKN.

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. KSKR-EAKN.

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. LPKK-DAKN.

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. AAKR-DAKN.

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. PSKR-EGKN.

FAS1 domain-containing protein CaO19.3004 is proteolytically cut by kexin (S08.070) cleavage. IKKR-DQKI.