KLLA0E04049p

UniProt : Q6CPL3, UniProt ID: Q6CPL3_KLULA,

KLLA0E04049p

Kluyveromyces lactis

MKLSDVCLGALLASLGSAGYITKRDVSQVGEANKKHVFMSFDKLRGNDASEASLSKRRVG
HLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFCSASRS
SSKKKRQDYTALLSSLLSVFGTDVATDYTYTGIASATGSAGTQTVPTALTSGTVAATSIR
SVPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDDVNVTG
LSFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTYNRYQYDNFPIVLQRNGVIEKNAYSVF
LNDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGIGVTSSYGN
ETVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCDSGSDYDLVFDF
GGFHIISPLSDYIVTTSSSSQCVLGILPQSDNEITLGDAFLTSAYVVYDLEELEISLAQA
SYTSGDEKIEVIRDSVPSAVAAPGYSSTWSTAASLSTGGNIFTVTNNANGTVSTGTGSSG
SGSSTSGNSGSTSTGSSSKKEGAASSLPVPHLAALICLLLSAVSIPSLF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KLLA0E04049p contains a PF00026 domain.

KLLA0E04049p is proteolytically cut by kexin (S08.070) cleavage. ITKR-DVSQ.

KLLA0E04049p is proteolytically cut by kexin (S08.070) cleavage. LKKR-ADGY.