Putative uncharacterized protein

UniProt : Q7SGV0, UniProt ID: Q7SGV0_NEUCR,

Putative uncharacterized protein

Neurospora crassa

MKLSAIATPLGLAALAIASNVLPRDFDSNDYYVLHLDARTSPTEVARSLGLSHEGPLGEL
QDHHLFVGRKAEHDIVKRELTERRRRKRSLGDEPHVLDSVLFSEKQILRKPWEKRMVPRP
VGPSRRGLFSDQEVDWAVKKQNEVIGNLGIRDPIFKEQWHLFNTVQTGHDVNVTGLWLEG
VTGKNATVAIVDDGLDMETDDLKDNYYAQGSWDFNDKGPDPKPRLSDDKHGTRCAGEVSA
GKNKACGVGVAYDSRIAGLRILSKLISDADEAVAMNYDFQHNQIYSCSWGPPDDGQSMDA
PGILIKRAMLNAVQKGRGGLGSIYVFASGNGAGNGDNCNFDGYTNSIYSITVGAVDRNGD
HPYYSESCSANLVVTYSSGGGDSIHTTDVGNACSDTHGGTSAAAPLAAGIFALVLQVRPD
LSWRDMQYLTVNTAVPINLDSGEWQTTAIGKQFSHMYGYGKLDSYAIVQAAKTWKKVKPQ
AWFYSPWIHVNKAIPQGDTGVAVSYEVTQAMLDEANVERLEHITVTMNIMHTRRGDLSVD
LISPNNLVSHLSVSRKNDEARAGYDDWTFMSVVHWGETGVGNWTIIVKDTQINSHEGVFT
DWHLKLWGESKDASKAKVLPMPTEEDDNDHAAIPTTTLPATTTTLPPQPIATDTKPSTVS
DHPNRPVNSKPTPTDAPNPSPTSDEQTSETTTPANSTWLPSFLPTFGKSAATMVWVYGSA
ALIGVFCISLAVYFWLARRKRLRNNPRGDYEFELLDEEEAEGLAGGGSSAEKRRAGAGGL
AGGKRTRGGELYDAFAGGSDDEDADDGVYRDRVDEVGSGSGSGSERASGSGSGSGSAGNG
GRQARALRSDSDDESGHHVVGDDDDDDDESDNDDGGHGSRPLRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00082 domain.

Putative uncharacterized protein contains a PF01483 domain.

Putative uncharacterized protein is proteolytically cut by kexin (S08.070) cleavage. WEKR-MVPR.