Homo sapiens

MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEW
GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQ
AWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRW
NFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by thermolysin (M04.001) cleavage. AHQP-WSRG.

is proteolytically cut by thermolysin (M04.001) cleavage. HWRR-AHCL.

is proteolytically cut by thermolysin (M04.001) cleavage. LGAK-TLPE.

is proteolytically cut by thermolysin (M04.001) cleavage. IGGR-ITGS.

is proteolytically cut by thermolysin (M04.001) cleavage. DTVK-VVGI.

is proteolytically cut by thermolysin (M04.001) cleavage. FNIN-YRIQ.

is proteolytically cut by thermolysin (M04.001) cleavage. VDKN-LTCP.

is proteolytically cut by thermolysin (M04.001) cleavage. FTCR-RCYR.

is proteolytically cut by thermolysin (M04.001) cleavage. PWSR-GGHC.

is proteolytically cut by trypsin () cleavage. SQAW-FTCR.