Pg-II fimbriae b

UniProt : Q8KHA3, UniProt ID: Q8KHA3_PORGI,

Pg-II fimbriae b

Porphyromonas gingivalis

MKLNKMFLVGALLSLGFASCSKEGNGPDPDNAAKSYMSMTLSMPMGSARAGDGQDQANPD
YHYVGEWAGKDKIEKVSIYMVPQGGPGLVESAEDLDFGTYYENPTIDPATHNAILKPKKG
IKVNSAVGKTVKVYVVLNDIAGKAKALLANVNAADFDAKFKEVIELSTQAEAVSQANAFN
GTAAGKIAKKNGATDETIMMTCFEPSAPLTIEAAVSEANAIAGVKNQAKVTVERSVARAM
VSTKEQTFVVKASSQIGAIAAGGELATITDIRWVVAQGERRQYLSKKRGTIQENTWVTPG
SDFVPTSSTFHTNATEYYDYAGLWEDHNTDPTVISGTQVPTLADYQLQNVTDELAQSLSG
KFLLPNTHKSGADAASSHYKRGNTAYVLVRAKFTPKKEAFIDRGKTYTDGSQVLDYVDGD
DFFVGENGQFYVSMKSVTDPKVGGVAGMKAHKYVKGKVLYYAWLNPSTTSPESWWNSPVV
RNNIYHIHIKSIKKLGFNWNPLVPDPDPSTNENPNNPDPNPDEPGTPIPTDPEQPLPDQD
TFMSVEVTVLPWLVHSYEVDL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pg-II fimbriae b is proteolytically cut by gingipain R (C25.001) cleavage. GSAR-AGDG.