Putative uncharacterized protein

UniProt : Q564E5, Q9WUK2, UniProt ID: IF4H_MOUSE, Q564E5_MOUSE,

Putative uncharacterized protein

Mus musculus

MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDA
IFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRK
QDKGGFGFRKGGPDDRGMGGSRESRGGWDSRDDFNSGYRDDFLGGRGGSRPGDRRAGPPM
GSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPRE
EVVQKEQE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00076 domain.

Putative uncharacterized protein is proteolytically cut by caspase-1 (C14.001) cleavage. DEVD-SLKE.

Putative uncharacterized protein is proteolytically cut by caspase-1 (C14.001) cleavage. VDSL-KEAL.