Amyloid protein A (Fragment)

UniProt : Q6FG67, UniProt ID: Q6FG67_HUMAN,

Amyloid protein A (Fragment)

Homo sapiens

MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY
DAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPE
KY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Amyloid protein A (Fragment) contains a PF00277 domain.

Amyloid protein A (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. FSFL-GEAF.

Amyloid protein A (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GPGG-VWAA.

Amyloid protein A (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. WAAE-AISD.

Amyloid protein A (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AYSD-MREA.

Amyloid protein A (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. GARD-MWRA.

Amyloid protein A (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AAEA-ISDA.

Amyloid protein A (Fragment) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. VWAA-EAIS.