Kex protein

UniProt : Q8TG29, UniProt ID: Q8TG29_PARBR,

Kex protein

Paracoccidioides brasiliensis

MKLLSVAVAVALFLVNPARASVSLRNHDAYDYFAIHLDPSVSPVQVAQMLGAQYEGQVGE
LADHHTFSISKELGVSVDRTLEDLRQRRRRRRRRRSLPNVEDLAVGDALDGILWSQKLTL
RPPMSKRAPPLPPPPQAKVRQSKPQDDQDRDYNATRKLNEIVSELEINDPIFTQQWHLFN
VKQPGHDLNVTGLWMEGITGNGAISAIVDDGLDMYSNDLKNNYFAEGSYDYNDDVDEPRP
RLYDDKHGTRCAGEVAGVRNDVCGVGVAYDSKVAGIRILSKPVSDEDEAASINYKYQDNQ
VYSCSWGPVDDGTTMDAPGILVQRAIVNGIQKGRGGKGSVYVFAAGNGALHEDNCNFDGY
TNSIYSVTVGAIDHNDKHPYYSEPCSAQLVVTYSSGGGNAIHTTDVGVNTCTTKHGGTSA
AGPLVVGVVALALSVRPELTWRDVQYILLETAIPVNLNESYWQDTATGKKFSHDYGYGKV
DAYSAVHLAMTWKLVKPQAWLHSPWLQVYADIPQGDKGLASSFEVTKELLVRNNVERLEH
VTLTMNINHTRRGDLSVELRSPTGAVSYLSTTRKLDDLRAGYVDWTFMSLVHWGESGIGK
WTVIVKDTIVNDFKGVFIDWQLSLWGEAIDADIQGLHPLPDEHDHDHNTELAPVATTTII
SSATSSKPTASVVPTDHIDRPVNTKPTGTQSPSQPSASSQPTPTSTSDSFLPSFFPTFGV
SKRTQVWIYGSLTLILIFCSTLGTYFLIQRRKRIRSNLHDDYEFEMIDDESDETAPLSTG
GHVAGARTGRKQRRKGGELYDAFAGGSDEELLSDGESESGSGEEPYRDEDERQDGGGVSE
TT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kex protein contains a PF00082 domain.

Kex protein contains a PF01483 domain.

Kex protein is proteolytically cut by kexin (S08.070) cleavage. MSKR-APPL.