PMAP: SubstrateDB : cDNA, FLJ93701, Homo sapiens diphtheria toxin receptor (heparin-binding epidermalgrowth factor-like growth factor) (DTR), mRNA (Heparin-binding EGF-like growth factor)

cDNA, FLJ93701, Homo sapiens diphtheria toxin receptor (heparin-binding epidermalgrowth factor-like growth factor) (DTR), mRNA (Heparin-binding EGF-like growth factor)

UniProt : B2R821, Q99075, UniProt ID: B2R821_HUMAN, HBEGF_HUMAN,

cDNA, FLJ93701, Homo sapiens diphtheria toxin receptor (heparin-binding epidermalgrowth factor-like growth factor) (DTR), mRNA (Heparin-binding EGF-like growth factor)

Homo sapiens

MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

cDNA, FLJ93701, Homo sapiens diphtheria toxin receptor (heparin-binding epidermalgrowth factor-like growth factor) (DTR), mRNA (Heparin-binding EGF-like growth factor) contains a PF00008 domain.

cDNA, FLJ93701, Homo sapiens diphtheria toxin receptor (heparin-binding epidermalgrowth factor-like growth factor) (DTR), mRNA (Heparin-binding EGF-like growth factor) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. RLRR-GLAA.