Heparin-binding EGF-like growth factor

UniProt : Q06186, Q5FW64, UniProt ID: HBEGF_MOUSE, Q5FW64_MOUSE,

Heparin-binding EGF-like growth factor

Mus musculus

MKLLPSVMLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGSTNQLLPTGGDRAQG
VQDLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGE
CRYLQEFRTPSCKCLPGYHGHRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDLESEEKVKLGVASSH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Heparin-binding EGF-like growth factor contains a PF00008 domain.

Heparin-binding EGF-like growth factor is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. LTLP-VENP.

Heparin-binding EGF-like growth factor is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. LTLP-VENP.

Heparin-binding EGF-like growth factor is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Heparin-binding EGF-like growth factor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. PSKE-RNGK.