PMAP: SubstrateDB : Alpha-S1-casein

Alpha-S1-casein

UniProt : P02662, UniProt ID: CASA1_BOVIN,

Alpha-S1-casein

Bos taurus

MKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIG
SESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQLLRLKKYK
VPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWY
YVPLGTQYTDAPSFSDIPNPIGSENSEKTTMPLW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Alpha-S1-casein contains a PF00363 domain.

Alpha-S1-casein is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PQEV-LNEN.

Alpha-S1-casein is proteolytically cut by polyporopepsin (A01.019) cleavage. LLRF-FVAP.

Alpha-S1-casein is proteolytically cut by polyporopepsin (A01.019) cleavage. RLKK-YKVP.

Alpha-S1-casein is proteolytically cut by chymosin (A01.006) cleavage. LLRF-FVAP.

Alpha-S1-casein is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PQEV-LNEN.

Alpha-S1-casein is proteolytically cut by polyporopepsin (A01.019) cleavage. LLRF-FVAP.

Alpha-S1-casein is proteolytically cut by polyporopepsin (A01.019) cleavage. RLKK-YKVP.

Alpha-S1-casein is proteolytically cut by chymosin (A01.006) cleavage. LLRF-FVAP.

Alpha-S1-casein is proteolytically cut by phytepsin (A01.020) cleavage. SGAW-YYVP.

Alpha-S1-casein is proteolytically cut by phytepsin (A01.020) cleavage. LLRF-FVAP.

Alpha-S1-casein is proteolytically cut by phytepsin (A01.020) cleavage. LAYF-YPEL.

Alpha-S1-casein is proteolytically cut by phytepsin (A01.020) cleavage. PELF-RQFY.