cDNA, FLJ92311, Homo sapiens apolipoprotein A-II (APOA2), mRNA

UniProt : B2R524, P02652, UniProt ID: APOA2_HUMAN, B2R524_HUMAN,

cDNA, FLJ92311, Homo sapiens apolipoprotein A-II (APOA2), mRNA

Homo sapiens

MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92311, Homo sapiens apolipoprotein A-II (APOA2), mRNA contains a PF04711 domain.

cDNA, FLJ92311, Homo sapiens apolipoprotein A-II (APOA2), mRNA is proteolytically cut by () cleavage. SLEG-ALVR.

cDNA, FLJ92311, Homo sapiens apolipoprotein A-II (APOA2), mRNA is proteolytically cut by () cleavage. LVRR-QAKE.

cDNA, FLJ92311, Homo sapiens apolipoprotein A-II (APOA2), mRNA is proteolytically cut by neutrophil elastase (S01.131) cleavage. FQTV-TDYG.