Sex-determining transformer protein 2

UniProt : P34709, UniProt ID: TRA2_CAEEL,

Sex-determining transformer protein 2

Caenorhabditis elegans

MKLKYNKLLVSVVIVTFVTFGLLLAECFGKSIDYQEKSIFPSFVSQGFFETRTNNEEYII
EKIAQTQENGVDMRSTLHFTQHGYLLNNISNLKIKFRQKTYTLNDVCFKPHITIFQQSSS
SDQNEYPHYIQRLLLEMQRLSPCLIVTPLNCFYDIYRIHGEISNWNKNTDFLNRRLRNSY
IEAIGENDERPYVKSNYGPSLIKSWADHMFDLPSKSFTNSTKDALFQKIKLWLLSIEPRQ
KTCAASIHSCDTPLDSEHYFNICTDMQSVDNFAEKKTKFKLEDVDEEFAMNLDCVDDQEQ
FIEWMQELEIRKMYSHVTEKPDYPNVVNQTCDKIFHDLNSTGIEFFDGSRSFSSTKSQFD
TMQTEIVLLTPEMLLSAMQHSDFVNGFESIWTIEKAEELIHEFRLALKEETEKFKENRMS
KMIRVTSRVLDNTVTTKLQSFSEKQTIHFVVNVHSLIVILFTIFVWSGAPLRSAFMFFVR
DALTCLLFCFVCSTDGVIVLDTELIKYIIVLTLANLYFTTRSSFCTERLSRCIQREKRFP
INSNFASLITVDTMTDSRQIQYFLSTVTKYQAAQDSYSNELFERFPKNWGCTSILIFPIV
FVYWYFIDSNFDKICVSVLPSFCLAAGEELFAKNMFWKEREAMQAKQRLENEEQAESITG
SSLEKLFAGNKPVSNTDKANIVKKSSIIRNQKPCLQDLSPGTYDVSNFMKYPHQASRIFR
EKIIGLYLRILKLRTLGVILCIPAILLIVISIGLLFIPVKRETLHTDSKQDDIFIEFEIF
NFSTNWKIVNQNLKQFSEDIESIGTLYTISNWQKSFERFEQETNKNASAEWNILFKWIND
EPINSAVTLFSEKSSGNQTIANPFKFRLRYGFDAKNETTVIEIVQKIDELLSKCSKNLSP
KAVGVLYEHYHRIAVVWNLFAFNQLTTAGIFIILLSIITFIFAITPTIKATFLFSLLVVG
TQIEVAALVHLFSLDHHQIYTNLALFAGFLAAWDPFCALLRYRRRILYKSETRRTPELAS
KRRVLLPIVATADIAQFFVLLITAFSILAIICSIVPELNIFFVPTVILIVIQIVAVFNSI
IVSIATKQMFESEVRHYLHRDLRGSTTAVRVYNLVQKQRLASSLDEPQVELDEFSIKRSS
PPCRYYAPPPKYSCKKRSRSSDEDEDSDPNQPGPSNRRSPKTGNKRVRGNGDNTELYIPN
RYELIVSGKSVGGNTSAAWNGPGSTLEQNMNALEECFELGVDEYDFDEHDGDEGCELVQD
MLDRERNLMNKRSTAQRRESRNIEKMKKSQENLDKEKSEEKISESKKNQDDSIESPNLPG
TPANLPVDEPLPPVGRLYIVEHVLPEEYRRDPLTEPPSMEDCIRAHSDPNLPPHPRADQY
PASFTRPMVEYCEDIYWTHRTGQLPPGLQVPRRPYDYYHITERTPPPEDLNWVPPAESPP
IPIPQQAFDLLEERRRNHREQQDEAREGDLSDPEV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sex-determining transformer protein 2 is proteolytically cut by calpain tra-3 (C02.009) cleavage. ATKQ-MFES.