Kininogen-1

UniProt : O08677, UniProt ID: KNG1_MOUSE,

Kininogen-1

Mus musculus

MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDFSLKQFNPGVKSGNQYMLHRVI
EGTKTDGSPTFYSFKYLIKEGNCSAQSGLAWQDCDFKDAEEAATGECTATVGKRENEFFI
VTQTCKIAPSKAPILKAYFPCIGCVHAISTDSPDLEPVLKHSIEHFNNNTDHSHLFTLRK
VKSAHRQVVAGLNFDITYTIVQTNCSKERFPSLHGDCVALPNGDDGECRGNLFMDINNKI
ANFSQSCTLYSGDDLVEALPKPCPGCPRDIPVDSPELKEVLGHSIAQLNAENDHPFYYKI
DTVKKATSQVVAGTKYVIEFIARETKCSKESNTELAEDCEIKHLGQSLDCNANVYMRPWE
NKVVPTVKCQALDMTEMARRPPGFSPFRSVTVQETKEGRTVSPPYIAREQEERDAETEQG
PTHGHGWLHEKQIKANKNHRGHKHGHDHGHWSPRRHGLGHGHQKPHGLGHGHQLKLDYLR
HQREDGDDHTHTVGHGHGHGHGHGHGHGHGHGHGHGHGHGHGHGKHTNKDKNSVKQTTQR
TESLASSSEYSTTSTQMQGRTEGPTLTPPRAQPTVTSSGFQDSDFIEDVVATTPPYDTGA
HDDLIPDIHVQPDSLSFKLISDFPEATSPKCPGRPWKPASWEDPNTETTEFSDFDLLDAL
S

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kininogen-1 contains a PF00031 domain.

Kininogen-1 contains a PF00031 domain.

Kininogen-1 contains a PF00031 domain.

Kininogen-1 is proteolytically cut by mouse kallikrein 6 (S01.167) cleavage. SPFR-SVTV.

Kininogen-1 is proteolytically cut by mouse kallikrein 6 (S01.167) cleavage. EMAR-RPPG.

Kininogen-1 is proteolytically cut by mouse kallikrein 6 (S01.167) cleavage. SPFR-SVTV.

Kininogen-1 is proteolytically cut by mouse kallikrein 6 (S01.167) cleavage. EMAR-RPPG.

Kininogen-1 is proteolytically cut by mouse kallikrein 1 (S01.164) cleavage. SPFR-SVTV.

Kininogen-1 is proteolytically cut by mouse kallikrein 1 (S01.164) cleavage. EMAR-RPPG.

Kininogen-1 is proteolytically cut by kallikrein mK9 (S01.071) cleavage. SPFR-SVTV.

Kininogen-1 is proteolytically cut by kallikrein mK9 (S01.071) cleavage. EMAR-RPPG.