T-kininogen 1

UniProt : P01048, UniProt ID: KNT1_RAT,

T-kininogen 1

Rattus norvegicus

MKLITILLLCSRLLPSLAQEEGAQELNCNDETVFQAVDTALKKYNAELESGNQFVLYRVT
EGTKKDGAETLYSFKYQIKEGNCSVQSGLTWQDCDFKDAEEAATGECTTTLGKKENKFSV
ATQICNITPGKGPKKTEEDLCVGCFQPIPMDSSDLKPVLKHAVEHFNNNTKHTHLFALRE
VKSAHSQVVAGMNYKIIYSIVQTNCSKEDFPSLREDCVPLPYGDHGECTGHTHVDIHNTI
AGFSQSCDLYPGDDLFELLPKNCRGCPREIPVDSPELKEALGHSIAQLNAQHNHIFYFKI
DTVKKATSQVVAGVIYVIEFIARETNCSKQSKTELTADCETKHLGQSLNCNANVYMRPWE
NKVVPTVRCQALDMMISRPPGFSPFRLVRVQETKEGTTRLLNSCEYKGRLSKARAGPAPD
HQAEASTVTP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

T-kininogen 1 contains a PF00031 domain.

T-kininogen 1 contains a PF00031 domain.

T-kininogen 1 contains a PF00031 domain.

T-kininogen 1 is proteolytically cut by kallikrein rK10 (S01.165) cleavage. LDMM-ISRP.

T-kininogen 1 is proteolytically cut by kallikrein rK10 (S01.165) cleavage. SPFR-LVRV.