Kininogen-1

UniProt : P08934, UniProt ID: KNG1_RAT,

Kininogen-1

Rattus norvegicus

MKLITILLLCSRLLPSLAQEEDAQEMDCNDESLFQAVDTALKKYNAGLKSGNQFVLYQVT
EGTKKDGSKTFYSFKYQIKEGNCSVQSGFAWQDCDFKDAEEAATGECTATLEKRRNNKFS
IATQICNITPGKGPIVTNEYHCLGCMHPISVDSPELGPVLKHAVEHFNNNTKHTHLFALG
EVKSADRQVVAGMNYQIIYSIVQTNCSKEDFPSLHEDCVPLPSGDDGECKGNAFVDIHKT
IAGFSDSCEFYPGDDLFELLPEDCPGCPRNIPVDSPELKEALGHSIAQLNAENNHTFYFK
IDTVKKATSQVVAGTKYVIEFIARETKCSKESNAELTADCETKRLGQSLNCNANVYMRPW
ENKVVPTVKCKVLDMTSVIRRPPGFSPFRAPRVKKPKESTTVSPSYIARVQEERDPGNEQ
GPIHGHGWLHAKQIKNKNHQGHKHGHGIGHGHQKPHGLGHGHQLKLDDLKQQREDGYDHR
HPVGHGHGQRHGHGHGHGHGRDKHTNKDKNNVKHTDQRRAPLTSSSEDNTTSTQIQGRTE
GFTLNPPLAQPAVISRGFQDSGFTEGVIATTSPYDTETHDDLIPDIHVQPDSLSFKLISD
FPEATSHKCPGRPWKPVSRKDPTIETTEFSDFDLLDALS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kininogen-1 contains a PF00031 domain.

Kininogen-1 contains a PF00031 domain.

Kininogen-1 contains a PF00031 domain.

Kininogen-1 is proteolytically cut by kallikrein rK1 (S01.405) cleavage. SPFR-APRV.

Kininogen-1 is proteolytically cut by kallikrein rK1 (S01.405) cleavage. SVIR-RPPG.

Kininogen-1 is proteolytically cut by neprilysin (M13.001) cleavage. GFSP-FRAP.