Kininogen-1

UniProt : P01042, UniProt ID: KNG1_HUMAN,

Kininogen-1

Homo sapiens

MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFS
VATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLN
EVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSG
KEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLD
DDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQE
KTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSF
NPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kininogen-1 contains a PF00031 domain.

Kininogen-1 contains a PF00031 domain.

Kininogen-1 contains a PF00031 domain.

Kininogen-1 is proteolytically cut by gingipain K (C25.002) cleavage..

Kininogen-1 is proteolytically cut by gingipain K (C25.002) cleavage..

Kininogen-1 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. GHTR-RHDW.

Kininogen-1 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. EKQR-KHNL.

Kininogen-1 is proteolytically cut by kallikrein hK2 (S01.161) cleavage. GHQR-GHGL.

Kininogen-1 is proteolytically cut by plasma kallikrein (S01.212) cleavage. GHTR-RHDW.