Isoform LMW of Kininogen-1

UniProt : B2RCR2, P01042, UniProt ID: B2RCR2_HUMAN, P01042-2,

Isoform LMW of Kininogen-1

Homo sapiens

MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRIT
EATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFS
VATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLN
EVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLR
IASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
IDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPW
EKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEP
ASEREVS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform LMW of Kininogen-1 contains a PF00031 domain.

Isoform LMW of Kininogen-1 contains a PF00031 domain.

Isoform LMW of Kininogen-1 contains a PF00031 domain.

Isoform LMW of Kininogen-1 is proteolytically cut by gingipain K (C25.002) cleavage..

Isoform LMW of Kininogen-1 is proteolytically cut by gingipain K (C25.002) cleavage..

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. ISLM-KRPP.

Isoform LMW of Kininogen-1 is proteolytically cut by (XM02-001) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. -RPP-GFSP.

Isoform LMW of Kininogen-1 is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. --RP-PGFS.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. ISLM-KRPP.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by penicillolysin (M35.001) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by aminopeptidase P1 (M24.009) cleavage. ---R-PPGF.

Isoform LMW of Kininogen-1 is proteolytically cut by aminopeptidase P2 (M24.005) cleavage. ---R-PPGF.

Isoform LMW of Kininogen-1 is proteolytically cut by carboxypeptidase M (M14.006) cleavage. FSPF-R---.

Isoform LMW of Kininogen-1 is proteolytically cut by carboxypeptidase N (M14.004) cleavage. FSPF-R---.

Isoform LMW of Kininogen-1 is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by (M12.307) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by lebetase (M12.164) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by (M9G.026) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by coccolysin (M04.007) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by coccolysin (M04.007) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by oligopeptidase F (M03.007) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by mitochondrial intermediate peptidase (M03.006) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by peptidyl-dipeptidase Dcp (M03.005) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by peptidyl-dipeptidase Dcp (M03.005) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by saccharolysin (M03.003) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by thimet oligopeptidase (M03.001) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by angiotensin-converting enzyme peptidase unit 2 (M02.004) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by peptidyl-dipeptidase Acer (M02.002) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by oligopeptidase E (C01.088) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by staphopain B (C47.002) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by staphopain B (C47.002) cleavage. SLMK-RPPG.

Isoform LMW of Kininogen-1 is proteolytically cut by chymase (S01.140) cleavage. FSPF-RSSR.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. VGKR-SSTK.

Isoform LMW of Kininogen-1 is proteolytically cut by gingipain K (C25.002) cleavage..

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. ISLM-KRPP.

Isoform LMW of Kininogen-1 is proteolytically cut by (XM02-001) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. -RPP-GFSP.

Isoform LMW of Kininogen-1 is proteolytically cut by prolyl oligopeptidase (S09.001) cleavage. --RP-PGFS.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. ISLM-KRPP.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK1 (S01.160) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by penicillolysin (M35.001) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by aminopeptidase P1 (M24.009) cleavage. ---R-PPGF.

Isoform LMW of Kininogen-1 is proteolytically cut by aminopeptidase P2 (M24.005) cleavage. ---R-PPGF.

Isoform LMW of Kininogen-1 is proteolytically cut by carboxypeptidase M (M14.006) cleavage. FSPF-R---.

Isoform LMW of Kininogen-1 is proteolytically cut by carboxypeptidase N (M14.004) cleavage. FSPF-R---.

Isoform LMW of Kininogen-1 is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by (M12.307) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by lebetase (M12.164) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by (M9G.026) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by coccolysin (M04.007) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by coccolysin (M04.007) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by oligopeptidase F (M03.007) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by mitochondrial intermediate peptidase (M03.006) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by peptidyl-dipeptidase Dcp (M03.005) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by peptidyl-dipeptidase Dcp (M03.005) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by saccharolysin (M03.003) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by thimet oligopeptidase (M03.001) cleavage. PPGF-SPFR.

Isoform LMW of Kininogen-1 is proteolytically cut by angiotensin-converting enzyme peptidase unit 2 (M02.004) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by peptidyl-dipeptidase Acer (M02.002) cleavage. GFSP-FR--.

Isoform LMW of Kininogen-1 is proteolytically cut by oligopeptidase E (C01.088) cleavage. RPPG-FSPF.

Isoform LMW of Kininogen-1 is proteolytically cut by staphopain B (C47.002) cleavage. SPFR-SSRI.

Isoform LMW of Kininogen-1 is proteolytically cut by staphopain B (C47.002) cleavage. SLMK-RPPG.

Isoform LMW of Kininogen-1 is proteolytically cut by chymase (S01.140) cleavage. FSPF-RSSR.

Isoform LMW of Kininogen-1 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. VGKR-SSTK.

Isoform LMW of Kininogen-1 is proteolytically cut by calpain-1 (C02.001) cleavage..