cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a)

UniProt : B2R4I2, P61956, UniProt ID: B2R4I2_HUMAN, SUMO2_HUMAN,

cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a)

Homo sapiens

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) contains a PF00240 domain.

cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) is proteolytically cut by SENP2 peptidase (C48.007) cleavage. QTGG-VY.

cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) is proteolytically cut by SENP2 peptidase (C48.007) cleavage. QTGG-VY.

cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) is proteolytically cut by SENP5 peptidase (C48.008) cleavage. QTGG-VY.