cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a)
|
UniProt : B2R4I2, P61956, UniProt ID: B2R4I2_HUMAN, SUMO2_HUMAN, cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) Homo sapiens MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) contains a PF00240 domain.
cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) is proteolytically cut by SENP2 peptidase (C48.007) cleavage. QTGG-VY.
cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) is proteolytically cut by SENP2 peptidase (C48.007) cleavage. QTGG-VY.
cDNA, FLJ92100, highly similar to Homo sapiens SMT3 suppressor of mif two 3 homolog 2 (yeast)(SUMO2), mRNA (SMT3 suppressor of mif two 3 homolog 2 (Yeast), isoform CRA_a) is proteolytically cut by SENP5 peptidase (C48.008) cleavage. QTGG-VY.