cDNA FLJ76035, highly similar to Homo sapiens carboxypeptidase B2 (plasma, carboxypeptidase U) (CPB2), transcript variant 1, mRNA

UniProt : A8K464, UniProt ID: A8K464_HUMAN,

cDNA FLJ76035, highly similar to Homo sapiens carboxypeptidase B2 (plasma, carboxypeptidase U) (CPB2), transcript variant 1, mRNA

Homo sapiens

MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTAD
LIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYY
EQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKYPLYVLKVSGKEQTAKNAIWIDCGI
HAREWISPAFCLWFIGHITQFYGIIGQYTNLLRLVDFYVMPVVNVDGYDYSWKKNRMWRK
NRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCGLYPESEPEVKAVASFLRRNI
NQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSE
TLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVI
RNV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76035, highly similar to Homo sapiens carboxypeptidase B2 (plasma, carboxypeptidase U) (CPB2), transcript variant 1, mRNA contains a PF00246 domain.

cDNA FLJ76035, highly similar to Homo sapiens carboxypeptidase B2 (plasma, carboxypeptidase U) (CPB2), transcript variant 1, mRNA contains a PF02244 domain.

cDNA FLJ76035, highly similar to Homo sapiens carboxypeptidase B2 (plasma, carboxypeptidase U) (CPB2), transcript variant 1, mRNA is proteolytically cut by thrombin (S01.217) cleavage. VSPR-ASAS.