Kit ligand

UniProt : P20826, UniProt ID: SCF_MOUSE,

Kit ligand

Mus musculus

MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAG
MDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAP
KNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKK
QSSLTRAVENIQINEEDNEISMLQQKEREFQEV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kit ligand contains a PF02404 domain.

Kit ligand is proteolytically cut by ADAM17 peptidase (M12.217) cleavage. PVAA-SSLR.

Kit ligand is proteolytically cut by ADAM19 peptidase (M12.214) cleavage. PVAA-SSLR.

Kit ligand is proteolytically cut by ADAM8 peptidase (M12.208) cleavage. PVAA-SSLR.

Kit ligand is proteolytically cut by ADAM33 peptidase (C14.003) cleavage. PVAA-SSLR.

Kit ligand is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. PVAA-SSLR.

Kit ligand is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. PPVA-ASSL.

Kit ligand is proteolytically cut by ADAM9 peptidase (M12.209) cleavage. VAAS-SLRN.