C-X-C motif chemokine 9

UniProt : Q07325, UniProt ID: CXCL9_HUMAN,

C-X-C motif chemokine 9

Homo sapiens

MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEK
IEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSR
QKKTT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-X-C motif chemokine 9 contains a PF00048 domain.

C-X-C motif chemokine 9 is proteolytically cut by dipeptidyl-peptidase IV (S09.003) cleavage. QGTP-VVRK.

C-X-C motif chemokine 9 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KVLK-VRKS.

C-X-C motif chemokine 9 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KVRK-SQRS.

C-X-C motif chemokine 9 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. VRKS-QRSR.