Caspase-7

UniProt : P55210, UniProt ID: CASP7_HUMAN,

Caspase-7

Homo sapiens

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Caspase-7 contains a PF00656 domain.

Caspase-7 is proteolytically cut by caspase-10 (C14.011) cleavage. IQAD-SGPI.

Caspase-7 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IQAD-SGPI.

Caspase-7 is proteolytically cut by caspase-10 (C14.011) cleavage. IQAD-SGPI.

Caspase-7 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IQAD-SGPI.

Caspase-7 is proteolytically cut by caspase-7 (C14.004) cleavage. DSVD-AKPD.

Caspase-7 is proteolytically cut by caspase-8 (C14.009) cleavage. IQAD-SGPI.

Caspase-7 is proteolytically cut by caspase-8 (C14.009) cleavage. NDTD-ANPR.

Caspase-7 is proteolytically cut by caspase-9 (C14.010) cleavage. IQAD-SGPI.

Caspase-7 is proteolytically cut by caspase-7 (C14.004) cleavage. NDTD-ANPR.

Caspase-7 is proteolytically cut by caspase-7 (C14.004) cleavage. IQAD-SGPI.

Caspase-7 is proteolytically cut by caspase-7 (C14.004) cleavage. TELD-DGIQ.

Caspase-7 is proteolytically cut by caspase-3 (C14.003) cleavage. DSVD-AKPD.

Caspase-7 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. IQAD-SGPI.