Epsilon-toxin type B

UniProt : Q02307, UniProt ID: ETXB_CLOPE,

Epsilon-toxin type B

Clostridium perfringens

MKKNLVKSLAIASAVISIYSIVNIVSPTNVIAKEISNTVSNEMSKKASYDNVDTLIEKGR
YNTKYNYLKRMEKYYPNAMAYFDKVTINPQGNDFYINNPKVELDGEPSMNYLEDVYVGKA
LLTNDTQQEQKLKSQSFTCKNTDTVTATTTHTVGTSIQATAKFTVPFNETGVSLTTSYSF
ANTNTNTNSKEITHNVPSQDILVPANTTVEVIAYLKKVNVKGNVKLVGQVSGSEWGEIPS
YLAFPRDGYKFSLSDTVNKSDLNEDGTININGKGNYSAVMGDELIVKVRNLNTNNVQEYV
IPVDKKEKSNDSNIVKYRSLYIKAPGIK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Epsilon-toxin type B contains a PF03318 domain.

Epsilon-toxin type B is proteolytically cut by lambda toxin (M04.011) cleavage. VQEY-VIPV.

Epsilon-toxin type B is proteolytically cut by lambda toxin (M04.011) cleavage. VSNE-MSKK.