Extracellular zinc metalloprotease

UniProt : Q2VL22, UniProt ID: Q2VL22_9BURK,

Extracellular zinc metalloprotease

Burkholderia cenocepacia

MKKLSRLLPITAITVASLSAFAQAGDQPAAVDKALQLIQQNPAAFSVAVSGAARTLKFAG
PQAAAPTDGDQFQVRDVIVDPDGTEHVRFDRFHAGLPVIGGDVVVHSSKGQLKQASVTQL
APINLAGTIGKVGNRAVVRNAPDVGATRARHIAAARFNSDVRRVDDAELVVFARDVTPTL
AYAVRVYGKATDTHGDAVLYYVDARTGTVLDAQDLIKTAAATGTGRSLYYGNLTLTTDQT
GTNAYRMLDPGRGGGSVYDGRGLSSDEVEQATDLPIFTSSTNVWGNNTTTDRQTVAADID
YGLALTWDYYKTTHNRNGIFNDGRGVKSYAHVVFNTGSGTTGANAAWLSSRVMAYGDGEP
GTRLPKPAVSVDVAGHEMSHGVTEATANLNYSGDAGGLNESTSDIFGTLVKFYANNPNDP
GNYVIGARVVSGGLRKMYKQDLDGRSFSCYPSGGFSWSNPRHDPHFSSGVGNRFFYLLSE
GPSVPSTDTGLSRAQLVCNGDTTFSGLGRDKAGKIWYRTLTVYLNANSSYPNARRASIQA
ANDLYGANSAESATVARAWSAVGVN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Extracellular zinc metalloprotease contains a PF01447 domain.

Extracellular zinc metalloprotease contains a PF02868 domain.

Extracellular zinc metalloprotease contains a PF07504 domain.

Extracellular zinc metalloprotease is proteolytically cut by (M04.022) cleavage..